GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PnTx-3-6   Click here for help

GtoPdb Ligand ID: 2542

Synonyms: ω-CNTX-Pn4a | ω-ctenitoxin-Pn4a | Neurotoxin Tx3-6 | PhAlpha-1-beta | PhAlpha-1-beta toxin
Compound class: Peptide
Comment: From Phoneutria nigriventer (Brazilian armed spider)
Click here for help
Peptide Sequence Click here for help
ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA
Ala-Cys-Ile-Pro-Arg-Gly-Glu-Ile-Cys-Thr-Asp-Asp-Cys-Glu-Cys-Cys-Gly-Cys-Asp-Asn-Gln-Cys-Tyr-Cys-Pro-Pro-Gly-Ser-Ser-Leu-Gly-Ile-Phe-Lys-Cys-Ser-Cys-Ala-His-Ala-Asn-Lys-Tyr-Phe-Cys-Asn-Arg-Lys-Lys-Glu-Lys-Cys-Lys-Lys-Ala
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 22, 15 and 37, 24 and 35, and 45 and 52