GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

tamapin   Click here for help

GtoPdb Ligand ID: 2319

Synonyms: potassium channel toxin α-KTx 5.4
Compound class: Peptide
Comment: From Mesobuthus tamulus (Eastern Indian scorpion)
Click here for help
Peptide Sequence Click here for help
AFCNLRRCELSCRSLGLLGKCIGEECKCVPY
Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2
Post-translational Modification
C-terminal tyrosine residue is predicted to undergo amidation; disulphide bond formation between cysteine residues at positions 3 and 21, 8 and 26, and 12 and 28.