From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

[Tyr36]-PTHrP-(1-36) amide (human)   Click here for help

GtoPdb Ligand ID: 1813

Synonyms: [Tyr36]-PTHrP 1-36 amide
Compound class: Peptide
Comment: Synthetic analogue of human PTHrP
Click here for help
Peptide Sequence Click here for help
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-NH2
Chemical Modification
C-terminal isoleucine residue in thre natural sequence is replaced by tyrosine amide