From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

dCX1_001   Click here for help

GtoPdb Ligand ID: 14549

Compound class: Peptide
Comment: dCX1_001 is a peptide C-X-C motif chemokine receptor 4 (CXCR4) antagonist [1].
Click here for help
Peptide Sequence Click here for help
MVLKAVSMPTGIYSKLKKEYGEEIEKKAKELGVKISYGYRNGEMLIGFSGKKEEVDKLVKYVKKIVTEISRKRN