From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

dNK1_070   Click here for help

GtoPdb Ligand ID: 14547

Compound class: Peptide
Comment: dNK1_070 is a peptide agonist of the tachykinin receptor 1 (NK1) GPCR [1].
Click here for help
Peptide Sequence Click here for help
EEKKRKILEEIIREHVFVAPGQSLRTIVSLIMEKYKNLSEEEIIAKLKEQNPEAAEEFKKRLEELKKE