GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

NN1213   Click here for help

GtoPdb Ligand ID: 13441

Synonyms: NN-1213 | peptide 21 [PMID: 38960379]
Compound class: Peptide
Comment: NN1213 is a synthetic human amylin analogue [1]. It is conjugated with a fatty acid (at Lys1) to improve its chemical stability and circulating half-life. NN1213 was selected for selectivity for AMY3 receptor compared to the calcitonin receptor. Amylin analogues have appetite suppressing action that has potential as a weight management strategy in the clinic.
Click here for help
Peptide Sequence Click here for help
KCNTATCATQRLADFLRHSSPNFGAIPSSTNVGSRTY-NH2
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Arg-His-Ser-Ser-Pro-Asn-Phe-Gly-Ala-Ile-Pro-Ser-Ser-Thr-Asn-Val-Gly-Ser-Arg-Thr-Tyr-Leu-Met-Asn-Pro-Gln-Arg-Ser-Thr-Val-Trp-Tyr-NH2
Chemical Modification
Disulphide bridge between Cys2/Cys7; fatty acid (C20diacid-gGlu-gGlu) congugation at Lys1.