GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ASIP [90-132 (L89Y)]   Click here for help

GtoPdb Ligand ID: 1327

Synonyms: agouti-signaling protein [90-132 (L89Y)] | agouti-signaling protein[90-132 (L89Y)]
Compound class: Peptide
Comment: Synthetic analogue of human ASIP (agouti)
Click here for help
Peptide Sequence Click here for help
YSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
Tyr-Ser-Ala-Pro-Cys-Val-Ala-Thr-Arg-Asn-Ser-Cys-Lys-Pro-Pro-Ala-Pro-Ala-Cys-Cys-Asp-Pro-Cys-Ala-Ser-Cys-Gln-Cys-Arg-Phe-Phe-Arg-Ser-Ala-Cys-Ser-Cys-Arg-Val-Leu-Ser-Leu-Asn-Cys
Chemical Modification
Leucine residue at position 89 of the natural sequence (here, N-terminal residue) is replaced by tyrosine