GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

bulevirtide   Click here for help

GtoPdb Ligand ID: 12775

Synonyms: BLV | bulevirtide-gmod | formerly Myrcludex B | Hepcludex®
Approved drug
bulevirtide is an approved drug (EMA (2020), UK HMRA (2021))
Compound class: Peptide
Comment: Bulevirtide is a lipopeptide antiviral agent. It blocks entry of the hepatitis-causing viruses HBV and HDV into hepatocytes [1]. The peptide structure of bulevirtide is derived from the pre-S1 domain of the large envelope protein of HBV surface antigen (HBsAg) [4], that binds to the hepatocyte expressed surface protein sodium/bile acid and sulphated solute cotransporter 1 (NTCP; SLC10A1) to mediate viral entry into host cells. Bulevirtide functionally blocks this entry process [3].
Peptide Sequence Click here for help
C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2
CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2