GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Eu-DTPA-hC3a   Click here for help

GtoPdb Ligand ID: 11286

 Ligand is labelled
Compound class: Peptide
Comment: Eu-DTPA-hC3a is a fluorescently labelled derivative of human C3a protein [1]. It exhibits full agonist activity at the C3aR and its potency and selectivity are comparable to native C3a.
Click here for help
Peptide Sequence Click here for help
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR
Ser-Val-Gln-Leu-Thr-Glu-Lys-Arg-Met-Asp-Lys-Val-Gly-Lys-Tyr-Pro-Lys-Glu-Leu-Arg-Lys-Cys-Cys-Glu-Asp-Gly-Met-Arg-Glu-Asn-Pro-Met-Arg-Phe-Ser-Cys-Gln-Arg-Arg-Thr-Arg-Phe-Ile-Ser-Leu-Gly-Glu-Ala-Cys-Lys-Lys-Val-Phe-Leu-Asp-Cys-Cys-Asn-Tyr-Ile-Thr-Glu-Leu-Arg-Arg-Gln-His-Ala-Arg-Ala-Ser-His-Leu-Gly-Leu-Ala-Arg
Chemical Modification
Europium diethylenetriaminepentaacetate conjugated at N-terminus to produce a fluorescent protein tracer.