GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: tat-M2NX
Compound class:
Peptide
Comment: TatM2NX is a cell permeable peptide-inhibitor (antagonist) of the transient receptor potential melastatin 2 (TRPM2) ion channel [1]. The M2NX portion of the peptide targets the Nudix motif ADP ribose binding site at the C-terminal of the TRPM2 channel and the N terminus tat-human immunodeficiency virus (HIV) sequence YGRKKRRQRRR mediates cell permeability. TatM2NX can be used as a tool to study TRPM2's role in brain physiology and pathophysiology, and its clinical potential as a novel neuroprotective target for the treatment of neurological diseases.
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV | |
| N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH | |
HELM Notation ![]() |
|
| PEPTIDE1{Y.G.R.K.K.R.R.Q.R.R.R.G.S.R.E.P.G.E.M.L.P.R.K.L.K.R.V.L.R.Q.E.F.W.V}$$$$ | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel