GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: ZP-1848 | ZP1848
Compound class:
Peptide
Comment: Glepaglutide (ZP1848, Zealand Pharma) is a long-acting human glucagon like peptide-2 (GLP-2) analogue with a C-terminal hexa-lysine addition.
The wild type peptide sequence is HADGSFSDEMNTILDNLAARDFINWLIQTKITD, compared to the glepaglutide sequence which is HGEGTFSSELATILDALAARDFIAWLIATKITDKKKKKK (the hexa-lysine is underlined). GLP-2 receptor agonists have therapeutic potential in clinical indications with compromised absorptive capacity at the intestinal mucosa, such as in short bowel syndrome. GLP-2 analogues have been designed to be less susceptible to enzymatic cleavage and renal clearance and hence have an improved circulating half-life compared to the endogenous peptide. Teduglutide is already approved but has a once-daily injection regimen, so longer-acting analogues are still of development interest. |
|
Classification ![]() |
|
Compound class | Peptide |
International Nonproprietary Names ![]() |
|
INN number | INN |
10481 | glepaglutide |
Synonyms ![]() |
ZP-1848 | ZP1848 |
Database Links ![]() |
|
CAS Registry No. | 914009-86-2 (source: WHO INN record) |
GtoPdb PubChem SID | 405560326 |
PubChem CID | 146170995 |
Search Google for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |
Search Google for chemicals with the same backbone | DOAUQKRTILFGHV |
Search PubMed clinical trials | glepaglutide |
Search PubMed titles | glepaglutide |
Search PubMed titles/abstracts | glepaglutide |
UniChem Compound Search for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |
UniChem Connectivity Search for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |