GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

tadekinig alfa   Click here for help

GtoPdb Ligand ID: 10077

Immunopharmacology Ligand
Compound class: Peptide
Comment: Tadekinig alfa is recombinant IL-18-binding protein in its mature form without the 30 amino acid signal peptide of the precursor protein (NP_001034748). It is being developed by AB2Bio.
Peptide Sequence Click here for help
TPVSQTTTAATASVRSTKDPHCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEH
LPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSS
PQQQG