GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

programmed cell death 1 ligand 1   Click here for help

GtoPdb Ligand ID: 9606

Abbreviated name: PD-L1
Synonyms: B7 homolog 1 | B7-H1 | PDL1 | programmed death ligand 1
Immunopharmacology Ligand
Comment: This is one of the ligands for the PD-1 receptor. It is a single-pass type I membrane protein. The PD-L1/PD-1 interaction is an established immune checkpoint. Both the ligand and receptor are targets for novel immuno-oncology therapeutics, as over-expression of either of these proteins is a mechanism used by tumour cells to evade immune detection and destruction. Already the target of approved immunotherapeutics in the form of monoclonal antibodies, small molecules targeting the PD-1/PD-L1 checkpoint are now in development to address the shortcomings associated with the current antibody therapies (including, poor susceptibility rate to single immune checkpoint pathway inhibitors, long half-life of antibodies and association with the development of adverse events, problems connected to the requirement for intravenous infusions) [9,20].
Species: Human
Peptide Sequence Click here for help
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSS
YRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGY
PKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
Post-translational Modification
Disulphide bonds: cys40-cys114, cys155-cys209 N-linked glycosylation at residues 35, 192, 200 and 219