GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

B and T lymphocyte attenuator   Click here for help

GtoPdb Ligand ID: 4891

Abbreviated name: BTLA
Synonyms: B- and T-lymphocyte attenuator  | B- and T-lymphocyte-associated protein | CD272
Immunopharmacology Ligand
Comment: BTLA is a negative immunomodulator. Interaction of BTLA with TNFRSF14 (HVEM) constitutes an immune checkpoint which inhibits T cell-mediated immune responses. Dysregulated BTLA expression contributes to immunosuppression and progression of some cancers [3-6] by enabling tumour immune evasion. Immunotherapeutics that block the BTLA-HVEM checkpoint offer potential as anti-tumour agents [8-9]. In the setting of inflammatory diseases anti-BTLA antibodies can induce inhibitory signalling and block T cell activation, thus reducing pro-inflammatory cytokine secretion [1].

Several anti-BTLA monoclonals have been progressed to clinical trials. Examples include:
Radanstobart (HFB200603, HiFiBiO; Phase 1 NCT05789069, solid tumours) [2]
Zadoprubart (ANB032, AnaptysBio; Phase 2 NCT05935085, atopic dermatitis; terminated due to insufficient efficacy) [1]
Venanprubart (LY3361237; development for autoimmune conditions terminated at Phase 2)
Tifcemalimab (JS004, icatolimab; Junshi Biosciences for advanced/metaststic solid tumours) [7]
GS-0272 (formerly MB272; Phase 1 NCT06031415 for rheumatoid arthritis was terminated).
Species: Human
Peptide Sequence Click here for help
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDN
GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSD
TAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSR
LARNVKEAPTEYASICVRS
Selected 3D Structures
PDB Id: 2aw2
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glcosylation of asparagine residues at positions 45, 64 and 80; disulphide bond formation between cysteine residues at positions 4 and 33, 28 and 85, and 42 and 49