urocortin 3

Ligand id: 928

Name: urocortin 3

Species: Human

Peptide Sequence
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
Post-translational Modification
The C-terminal isoleucine is amidated.