IL-17C   

GtoPdb Ligand ID: 5875

Synonyms: cytokine CX2 | interleukin-17C
Comment: IL-17C is an IL-17 homolog, secreted by epithelial cells in response to bacterial challenge and inflammatory stimuli and that acts in an autocrine manner to control the innate epithelial immune responses necessary for regulating intestinal inflammation and barrier function [1-2].
In light of the potential clinical benefits arising from pharmacological inhibition of IL-17C activity, Galapagos NV, in collaboration with MorphoSys, have the first-in-class anti-IL-17C monoclonal antibody, MOR106, in clinical development for atopic dermatitis (see completed Phase 1 study NCT02739009).
Species: Human
Peptide Sequence
HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLE
ADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAF
HTEFIHVPVGCTCVLPRSV
His-His-Asp-Pro-Ser-Leu-Arg-Gly-His-Pro-His-Ser-His-Gly-Thr-Pro-His-Cys-Tyr-Ser-Ala-Glu-Glu-Leu-Pro-Leu-Gly-Gln-Ala-Pro-Pro-His-Leu-Leu-Ala-Arg-Gly-Ala-Lys-Trp-Gly-Gln-Ala-Leu-Pro-Val-Ala-Leu-Val-Ser-Ser-Leu-Glu-Ala-Ala-Ser-His-Arg-Gly-Arg-His-Glu-Arg-Pro-Ser-Ala-Thr-Thr-Gln-Cys-Pro-Val-Leu-Arg-Pro-Glu-Glu-Val-Leu-Glu-Ala-Asp-Thr-His-Gln-Arg-Ser-Ile-Ser-Pro-Trp-Arg-Tyr-Arg-Val-Asp-Thr-Asp-Glu-Asp-Arg-Tyr-Pro-Gln-Lys-Leu-Ala-Phe-Ala-Glu-Cys-Leu-Cys-Arg-Gly-Cys-Ile-Asp-Ala-Arg-Thr-Gly-Arg-Glu-Thr-Ala-Ala-Leu-Asn-Ser-Val-Arg-Leu-Leu-Gln-Ser-Leu-Leu-Val-Leu-Arg-Arg-Arg-Pro-Cys-Ser-Arg-Asp-Gly-Ser-Gly-Leu-Pro-Thr-Pro-Gly-Ala-Phe-Ala-Phe-His-Thr-Glu-Phe-Ile-His-Val-Pro-Val-Gly-Cys-Thr-Cys-Val-Leu-Pro-Arg-Ser-Val
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 111 and 171, and 106 and 173.