C5a des-Arg   Click here for help

GtoPdb Ligand ID: 574

Synonyms: C5a des-Arg74
Compound class: Endogenous peptide in human, mouse or rat
Comment: C5a des-Arg is a natural breakdown product of C5a via the serum enzyme carboxypeptidase B from 74 to 73 amino acids.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG
Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly
Post-translational Modification
C5a des-ARG is one C-terminal amino acid shorter than C5a due to degradation by the serum enzyme carboxypeptidase B