placental growth factor   Click here for help

GtoPdb Ligand ID: 5314

Synonyms: PIGF
Comment: Biologically active placental growth factor is an antiparellel homodimer
Species: Human
Peptide Sequence Click here for help
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVE
TANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAV
WPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
Post-translational Modification
Interchain disulphide bonds between cysteine residues at positions 77 ad 86; intrachain disulphide bonds between cysteine residues at positions 34 and 76, 65 and 110, and 69 and 112. Predicted N-linked glycosylation on asparagine residues at positions 15 and 83