OX-40 ligand   Click here for help

GtoPdb Ligand ID: 5076

Synonyms: glycoprotein Gp34 | TXGP-1
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: OX40L (CD252) is the ligand for tumor necrosis factor receptor superfamily, member 4 (TNFRSF4, a.k.a. OX40 or CD134). OX40 is a secondary co-stimulatory immune checkpoint molecule expressed on activated T cells (requiring CD28 co-stimulatory signal), and OX40L is expressed on activated dendritic cells. The OX40/OX40L pair is involved in late T-cell costimulatory signaling and both are transiently expressed following antigen recognition, and blocking OX40/OX40L is reported to prevent the development of disease in in vivo autoimmune and inflammatory disease models [4]. The OX40/OX40L pathway is being investigated for the development of novel anti-inflammatory therapeutics and anti-cancer drugs.
An antibody binding mouse OX40L
Species: Human
Peptide Sequence Click here for help
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQ
KEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL
DDFHVNGGELILIHQNPGEFCVL
Selected 3D Structures
PDB Id: 2HEV
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residue at position 152; predicted N-linked glycosylation of asparagines at positions 90, 114 and 157; disulphide bond formation between cysteine residues at positions 97 and 181