Abbreviated name: IGF-1
Synonyms: CEP-151 | mechano growth factor (MGF) | myotrophin
insulin-like growth factor 1 is an approved drug (FDA (2005))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The recombinant form of human IGF-1 is an approved drug, mecasermin.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: insulin-like growth factor 1 |
Peptide Sequence | |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Selected 3D Structures | ||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 6 and 48, 18 and 61, and 47 and 52 |