Synonyms: IFN-alpha-2 | interferon alpha-2 | Roferon A®
IFN-α2 is an approved drug (FDA (1989))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α2 is a type I IFN. The sequence of the recombinant peptide used clinically and known as interferon alfa-2a, is identical to that of human IFN-α2. Interferon α-2a has anti-viral, immunomodulatory and antineoplastic actions.
Pegylated IFN-α-2a is on the World Health Organization's List of Essential Medicines.
Species: Human
|
Peptide Sequence | |
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETL LDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQES LRSKE |
Selected 3D Structures | ||
|
Post-translational Modification | |
O-linked glycosylation of threonine residue at position 106; disulphide bond between cysteine residues at positions 1 and 98, and 29 and 138 |