BMP-6   Click here for help

GtoPdb Ligand ID: 4885

Synonyms: VG-1-R | VG-1-related protein | VGR-1
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
SASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMN
ATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Selected 3D Structures
PDB Id: 2QCW
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 103 of each chain. Predicted N-linked glycososylation of asparagine residues at positions 12, 30 and 80. Predicted disulphide bond formation between cysteine residues at positions 38 and 104, 67 and 136, and 71 and 138