CCL7

Ligand id: 4414

Name: CCL7

Species: Rat

Peptide Sequence
QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
Gln-Pro-Asp-Gly-Thr-Asn-Ser-Ser-Thr-Cys-Cys-Tyr-Val-Lys-Lys-Gln-Lys-Ile-Pro-Lys-Arg-Asn-Leu-Lys-Ser-Tyr-Arg-Lys-Ile-Thr-Ser-Ser-Arg-Cys-Pro-Trp-Glu-Ala-Val-Ile-Phe-Lys-Thr-Lys-Lys-Gly-Met-Glu-Val-Cys-Ala-Glu-Ala-His-Gln-Lys-Trp-Val-Glu-Glu-Ala-Ile-Ala-Tyr-Leu-Asp-Met-Lys-Thr-Ser-Thr-Pro-Lys-Pro