CXCL14   Click here for help

GtoPdb Ligand ID: 3680

Synonyms: BMAC
Immunopharmacology Ligand
Comment: CXCL14 is a C-X-C motif chemokine with a broad spectrum of biological activities.
Species: Human
Peptide Sequence Click here for help
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Ser-Lys-Cys-Lys-Cys-Ser-Arg-Lys-Gly-Pro-Lys-Ile-Arg-Tyr-Ser-Asp-Val-Lys-Lys-Leu-Glu-Met-Lys-Pro-Lys-Tyr-Pro-His-Cys-Glu-Glu-Lys-Met-Val-Ile-Ile-Thr-Thr-Lys-Ser-Val-Ser-Arg-Tyr-Arg-Gly-Gln-Glu-His-Cys-Leu-His-Pro-Lys-Leu-Gln-Ser-Thr-Lys-Arg-Phe-Ile-Lys-Trp-Tyr-Asn-Ala-Trp-Asn-Glu-Lys-Arg-Arg-Val-Tyr-Glu-Glu
Post-translational Modification
Disulphide bond formation between amino acid residues at positions 3 and 29 and 5 and 50