CCL27   Click here for help

GtoPdb Ligand ID: 3646

Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Although CCL27 is reported as the endogenous ligand for the CCR10 chemokine receptor as shown by the specificity of a calcium flux assay, no affinity value is provided [1].
Species: Human
Peptide Sequence Click here for help
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLN
FGMLRKMG
Phe-Leu-Leu-Pro-Pro-Ser-Thr-Ala-Cys-Cys-Thr-Gln-Leu-Tyr-Arg-Lys-Pro-Leu-Ser-Asp-Lys-Leu-Leu-Arg-Lys-Val-Ile-Gln-Val-Glu-Leu-Gln-Glu-Ala-Asp-Gly-Asp-Cys-His-Leu-Gln-Ala-Phe-Val-Leu-His-Leu-Ala-Gln-Arg-Ser-Ile-Cys-Ile-His-Pro-Gln-Asn-Pro-Ser-Leu-Ser-Gln-Trp-Phe-Glu-His-Gln-Glu-Arg-Lys-Leu-His-Gly-Thr-Leu-Pro-Lys-Leu-Asn-Phe-Gly-Met-Leu-Arg-Lys-Met-Gly
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 9 and 38 and 10 and 33