gastrin-34   Click here for help

GtoPdb Ligand ID: 3562

Synonyms: big gastrin
Comment: Sulfated form of gastrin-34.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: gastrin-34

Peptide Sequence Click here for help
XLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
pGlu-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The N-terminal glutamic acid cyclizes into pyroglutamic acid (represented by pGlu and X), the tyrosine residue at position 29 is sulfated (represented by Tys) and the C-terminal phenylalanine is amidated.