CCK-58   Click here for help

GtoPdb Ligand ID: 3552

Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: cck-58

Peptide Sequence Click here for help
VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Val-Ser-Gln-Arg-Thr-Asp-Gly-Glu-Ser-Arg-Ala-His-Leu-Gly-Ala-Leu-Leu-Ala-Arg-Tyr-Ile-Gln-Gln-Ala-Arg-Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Ile-Val-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 52 is sulfated, as indicated by Tys which represents Tyr(SO3H).