ulinastatin   Click here for help

GtoPdb Ligand ID: 10359

Synonyms: Miraclid® | Ulinase® | Urinastatin®
Approved drug Immunopharmacology Ligand
ulinastatin is an approved drug (Japan, China)
Comment: Ulinastatin is considered to be a metabolite of inter-α-trypsin inhibitor (ITI) that is one of the cleavage products from the AMBP precursor protein [3]. Compared to full length ITI, ulinastatin lacks the carboxyterminal RFSN amino acids. Functionally ulinastatin is a protease inhibitor, that plays an important role in physiological and pathological processes, and has notable anti-inflammatory activity [1-2,6]. It can be purified from healthy human urine or produced using recombinant technology.
Species: Human
Peptide Sequence Click here for help
AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVA
ACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELL
Post-translational Modification
N-glycan at Asn45, glycosaminoglycan chain of low-sulfated chondroitin 4-sulfate at Ser10