ulinastatin

Ligand id: 10359

Name: ulinastatin

Species: Human

Peptide Sequence
AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVA
ACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELL
Post-translational Modification
N-glycan at Asn45, glycosaminoglycan chain of low-sulfated chondroitin 4-sulfate at Ser10