selectin P ligand   

GtoPdb Ligand ID: 10014

Comment: P-selectin glycoprotein ligand 1 (PSLG-1) is a single transmembrane proteoglycan that is expressed on leukocyte membranes. It interacts with E-, P- and L-selectins on endothelial cell surfaces.
We provide the amino acid sequence for the mature form of the ligand (amino acids 42-412), without its signal and propeptide sequences.
Species: Human
Peptide Sequence
QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEI
QTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEA
QTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRG
LFIPFSVSSVTHKGIPMAASNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPTE
MVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP